- Recombinant Nostoc sp. Photosystem I reaction center subunit PsaK 1 (psaK1)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1053425
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 8,847 Da
- E Coli or Yeast
- Photosystem I reaction center subunit PsaK 1 (psaK1)
- 31656
Sequence
AATTPLEWSPTVGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAFGHILGVGLVLGLHNLGRI